PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G02195.1.p
Common NameEUGRSUZ_G02195, LOC104453725
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 234aa    MW: 26237.5 Da    PI: 8.6228
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G02195.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171360148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W+++Ed++l+d+++++G g+W+t ++  g+ R++k+c++rw +yl
  Eucgr.G02195.1.p 13 KGAWSKQEDQKLIDYIQKHGEGSWRTLPQAAGLLRCGKSCRLRWINYL 60
                      79******************************99************97 PP

2Myb_DNA-binding52.21.4e-1666111148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.G02195.1.p  66 RGNFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111
                       8999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.6E-23463IPR009057Homeodomain-like
PROSITE profilePS5129416.219860IPR017930Myb domain
SuperFamilySSF466893.26E-2911107IPR009057Homeodomain-like
SMARTSM007175.1E-131262IPR001005SANT/Myb domain
PfamPF002497.2E-161360IPR001005SANT/Myb domain
CDDcd001674.26E-101560No hitNo description
PROSITE profilePS5129426.90661115IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-2664115IPR009057Homeodomain-like
SMARTSM007171.0E-1565113IPR001005SANT/Myb domain
PfamPF002493.6E-1566111IPR001005SANT/Myb domain
CDDcd001674.14E-1168111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MRKPCCDKRD TNKGAWSKQE DQKLIDYIQK HGEGSWRTLP QAAGLLRCGK SCRLRWINYL  60
RPDLKRGNFA EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH LRRKLLKMGI  120
DPNNHRLNQN LPRSQTPDAS GSTSSSSMKT NMTLADKSSR SAGDHPEVFD AENVSGDIPR  180
DLPDLNLDLT ISVPSSSLTK VEEEEQNPYA SKVATKVARD IENAESPTLL LFA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-301011524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G02195.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066635.11e-173PREDICTED: myb-related protein 308-like
SwissprotQ9SZP18e-79MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A059BFE71e-173A0A059BFE7_EUCGR; Uncharacterized protein
STRINGVIT_01s0011g04760.t011e-108(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.19e-79myb domain protein 4